PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA07G05990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 457aa    MW: 49305 Da    PI: 5.9891
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA07G05990.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.9e-17104150148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEde l + v+ +G++ W+ Ia+ ++ gR +kqc++rw ++l
  ONIVA07G05990.1 104 KGGWTREEDEVLRQMVRHHGNRKWAEIAKSLP-GRVGKQCRERWTNHL 150
                      688*****************************.************996 PP

2Myb_DNA-binding51.91.7e-16158198345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd  l++a++ +G+  W++Ia++++ gR+++ +k++w+
  ONIVA07G05990.1 158 IWTEEEDMMLIEAHQTYGNS-WSAIAKRLP-GRSENTIKNHWN 198
                      6*****************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.99499154IPR017930Myb domain
SuperFamilySSF466891.01E-30101197IPR009057Homeodomain-like
SMARTSM007173.4E-15103152IPR001005SANT/Myb domain
PfamPF002491.1E-15104150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-26106157IPR009057Homeodomain-like
CDDcd001671.79E-15107150No hitNo description
SMARTSM007171.0E-16155203IPR001005SANT/Myb domain
PROSITE profilePS5129416.33155205IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-22158202IPR009057Homeodomain-like
PfamPF002491.5E-15159198IPR001005SANT/Myb domain
CDDcd001676.72E-14159201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MAAAGNSFLN QELVKAADGH LSSSSHGGTC HTNTRAAPIT VGVPDLGCPV SSIGVATSSS  60
LTPKEGLATA SYNSVVAFPV GATMVPQQQQ TQAAGSNDNP GLVKGGWTRE EDEVLRQMVR  120
HHGNRKWAEI AKSLPGRVGK QCRERWTNHL HPDIKKDIWT EEEDMMLIEA HQTYGNSWSA  180
IAKRLPGRSE NTIKNHWNAT KRSLNSKRRL RKKNSEETVP GQPSLLENYI RSCQHMLPSE  240
IAPPPPAPPA PFDISRYGNS GVIGASPIVP VVQEPSTSTP PGLVMFLDLL NQAIPHPPQP  300
ETMDLFNMTP EVSHLNTSGY CLQLDAGGNL YYGQLPAPAP VQPHGINTQE LQDTPHLSLY  360
YPLSSFAGSH TDGTVEFDHQ LSNPDGGHYG EEAGPSSVAA GGSANGMDDN DVVQMASNQF  420
MMPSEDEGNS FLNQELLMVV NNMTDSHIMR SHGGASY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-421002063110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.10.0PREDICTED: transcription factor RAX1-like
TrEMBLA0A0E0HY670.0A0A0E0HY67_ORYNI; Uncharacterized protein
STRINGLOC_Os07g12130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-46myb domain protein 98